HORDB

General Information

ID: hor006443
Uniprot ID: P68259
Protein name: Glucagon-like peptide 1
Gene name: GCG
Organism: Gallus gallus (Chicken)
Family: Glucagon family
Source: Animal
Expression: Produced in the A cells of the islets of Langerhans in response to a drop in blood sugar concentration.
Disease: NA
Comments: NA
Taxonomy: Gallus (genus), Phasianinae (subfamily), Phasianidae (family), Galliformes (order), Galloanserae (superorder), Neognathae (infraclass), Aves (class), Coelurosauria, Theropoda, Saurischia, Dinosauria, Archosauria, Archelosauria, Sauria, Sauropsida, Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005179 hormone activity; GO:0031769 glucagon receptor binding; GO:0042802 identical protein binding; GO:0048018 receptor ligand activity
GO BP: GO:0006094 gluconeogenesis; GO:0007188 adenylate cyclase-modulating G protein-coupled receptor signaling pathway; GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway; GO:0010737 protein kinase A signaling; GO:0010800 positive regulation of peptidyl-threonine phosphorylation; GO:0014823 response to activity; GO:0032099 negative regulation of appetite; GO:0033138 positive regulation of peptidyl-serine phosphorylation; GO:0035774 positive regulation of insulin secretion involved in cellular response to glucose stimulus; GO:0042593 glucose homeostasis; GO:0043066 negative regulation of apoptotic process; GO:0045722 positive regulation of gluconeogenesis; GO:0050796 regulation of insulin secretion; GO:0050896 response to stimulus; GO:0051571 obsolete positive regulation of histone H3-K4 methylation; GO:0070374 positive regulation of ERK1 and ERK2 cascade; GO:0071377 cellular response to glucagon stimulus; GO:0090280 positive regulation of calcium ion import; GO:1900118 negative regulation of execution phase of apoptosis
GO CC: GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0005737 cytoplasm; GO:0005886 plasma membrane

Sequence Information

Sequence: HAEGTYTSDITSYLEGQAAKEFIAWLVNGRG
Length: 31(118-148)
Propeptide: MKMKSIYFIAGLLLMIVQGSWQNPLQDTEEKSRSFKASQSEPLDESRQLNEVKRHSQGTFTSDYSKYLDSRRAQDFVQWLMSTKRNGQQGQEDKENDKFPDQLSSNAISKRHSEFERHAEGTYTSDITSYLEGQAAKEFIAWLVNGRGRRDFPEKALMAEEMGRRHADGTFTSDINKILDDMAAKEFLKWLINTKVTQRDLLGEYQ
Signal peptide: MKMKSIYFIAGLLLMIVQGSWQ
Modification: T30 Arginine amide
Glycosylation: NA
Mutagenesis: NA

Activity

Function: [Glucagon]: Plays a key role in glucose metabolism and homeostasis. Regulates blood glucose by increasing gluconeogenesis and decreasing glycolysis.
Mechanism: NA
Cross BBB: NA
Target: GLP2R
Target Unid: C4P7J2
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure

Disulfide bond: NA
Structure ID: AF-P68259-F1(AlphaFold_DB_ID)

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor006443_AF2.pdb

hor006443_ESM.pdb

Physical Information

Mass:	392099	Formula:	C151H226N40O49
Absent amino acids:	CMP	Common amino acids:	AG
pI:	4.58	Basic residues:	3
Polar residues:	12	Hydrophobic residues:	11
Hydrophobicity:	-34.19	Boman Index:	-4122
Half-Life:	3.5 hour	Half-Life Yeast:	10 min
Half-Life E.Coli:	>10 hour	Aliphatic Index	72.58
Instability Index:	59.35	Extinction Coefficient cystines:	8480
Absorbance 280nm:	282.67

Literature

PubMed ID: 2338135
Title: Nucleotide sequence determination of chicken glucagon precursor cDNA. Chicken preproglucagon does not contain glucagon-like peptide II.
PubMed ID: 7776976
Title: Trout and chicken proglucagon: alternative splicing generates mRNA transcripts encoding glucagon-like peptide 2.
PubMed ID: 1194290
Title: Chic
PubMed ID: 2828209
Title: